![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein automated matches [191280] (4 species) not a true protein |
![]() | Species Homo sapiens, [TaxId:9606] [229907] (1 PDB entry) |
![]() | Domain d4mq7a1: 4mq7 A:6-183 [229908] Other proteins in same PDB: d4mq7a2, d4mq7b_ automated match to d3hujc1 complexed with cis, nag |
PDB Entry: 4mq7 (more details), 2.6 Å
SCOPe Domain Sequences for d4mq7a1:
Sequence, based on SEQRES records: (download)
>d4mq7a1 d.19.1.1 (A:6-183) automated matches {Homo sapiens, [TaxId: 9606]} rlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwet lqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdils fqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk
>d4mq7a1 d.19.1.1 (A:6-183) automated matches {Homo sapiens, [TaxId: 9606]} rlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwet lqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhnnffhvafqgkdilsfqgts weptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk
Timeline for d4mq7a1: