Lineage for d4mq7a1 (4mq7 A:6-183)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2163004Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2163005Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2163006Family d.19.1.1: MHC antigen-recognition domain [54453] (13 protein domains)
  6. 2163926Protein automated matches [191280] (3 species)
    not a true protein
  7. 2163933Species Human (Homo sapiens) [TaxId:9606] [189896] (31 PDB entries)
  8. 2163960Domain d4mq7a1: 4mq7 A:6-183 [229908]
    Other proteins in same PDB: d4mq7a2, d4mq7a3, d4mq7b_
    automated match to d3hujc1
    complexed with cis, nag

Details for d4mq7a1

PDB Entry: 4mq7 (more details), 2.6 Å

PDB Description: structure of human cd1d-sulfatide
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d, Cd1d1 protein

SCOPe Domain Sequences for d4mq7a1:

Sequence, based on SEQRES records: (download)

>d4mq7a1 d.19.1.1 (A:6-183) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwet
lqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdils
fqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk

Sequence, based on observed residues (ATOM records): (download)

>d4mq7a1 d.19.1.1 (A:6-183) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwet
lqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhnnffhvafqgkdilsfqgts
weptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk

SCOPe Domain Coordinates for d4mq7a1:

Click to download the PDB-style file with coordinates for d4mq7a1.
(The format of our PDB-style files is described here.)

Timeline for d4mq7a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d4mq7b_