SCOPe 2.03: Domain d4mlpb1: 4mlp B:21-223

Lineage for d4mlpb1 (4mlp B:21-223)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families)
   automatically mapped to Pfam PF00875

5. Family c.28.1.0: automated matches [227292] (1 protein)
   not a true family

6. Protein automated matches [227113] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [226619] (4 PDB entries)

8. Domain d4mlpb1: 4mlp B:21-223 [229903]
   Other proteins in same PDB: d4mlpb2, d4mlpc2
   automated match to d4mlpd1
   complexed with 2cx

Details for d4mlpb1

PDB Entry: 4mlp, 1.94 Å

PDB Description: Mammalian cryptochrome in complex with a small molecule competitor of its ubiquitin ligase

PDB Compounds: (B:) Cryptochrome-2

SCOPe Domain Sequences for d4mlpb1:

Sequence; same for both SEQRES and ATOM records:

>d4mlpb1 c.28.1.0 (B:21-223) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
assvhwfrkglrlhdnpallaavrgarcvrcvyildpwfaasssvginrwrfllqsledl
dtslrklnsrlfvvrgqpadvfprlfkewgvtrltfeydsepfgkerdaaimkmakeagv
evvtenshtlydldriielngqkppltykrfqalisrmelpkkpavavssqqmescraei
qenhddtygvpsleelgfptegl

Timeline for d4mlpb1:

• d4mlpb1 is new in SCOPe 2.03-stable
  
• d4mlpb1 appears in SCOPe 2.04
  
• d4mlpb1 appears in the current release, SCOPe 2.08