SCOPe 2.05: Domain d4lyfc_: 4lyf C:

Lineage for d4lyfc_ (4lyf C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (27 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (145 PDB entries)

8. Domain d4lyfc_: 4lyf C: [229880]
   automated match to d4lrwa_
   complexed with 21c, gdp

Details for d4lyfc_

PDB Entry: 4lyf, 1.57 Å

PDB Description: crystal structure of small molecule vinylsulfonamide 8 covalently bound to k-ras g12c

PDB Compounds: (C:) GTPase KRas

SCOPe Domain Sequences for d4lyfc_:

Sequence, based on SEQRES records:

>d4lyfc_ c.37.1.8 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
teyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildtagq
eeysamrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksdlp
srtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk

Sequence, based on observed residues (ATOM records):

>d4lyfc_ c.37.1.8 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
teyklvvvgacgvgksaltiqliqnhfvsyrkqvvidgetslldildtagqeeyrdqymr
tgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksdlpsrtvdtkqaqdl
arsygipfietsaktrqgvddafytlvreirkhk

Timeline for d4lyfc_:

• d4lyfc_ first appeared in SCOPe 2.03
  
• d4lyfc_ appears in SCOPe 2.04
  
• d4lyfc_ appears in SCOPe 2.06
  
• d4lyfc_ appears in the current release, SCOPe 2.08