Lineage for d4luca_ (4luc A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868094Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)
  8. 2868122Domain d4luca_: 4luc A: [229866]
    automated match to d4lrwa_
    complexed with 20g, ca, gdp

Details for d4luca_

PDB Entry: 4luc (more details), 1.29 Å

PDB Description: crystal structure of small molecule disulfide 6 bound to k-ras g12c
PDB Compounds: (A:) GTPase KRas

SCOPe Domain Sequences for d4luca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4luca_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildtag
qeeysamrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke

SCOPe Domain Coordinates for d4luca_:

Click to download the PDB-style file with coordinates for d4luca_.
(The format of our PDB-style files is described here.)

Timeline for d4luca_: