Lineage for d4lqub1 (4lqu B:2-231)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2164733Family d.22.1.1: Fluorescent proteins [54512] (6 protein domains)
  6. 2164737Protein Green fluorescent protein, GFP [54513] (4 species)
  7. 2164743Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (175 PDB entries)
    Uniprot P42212
  8. 2164839Domain d4lqub1: 4lqu B:2-231 [229862]
    Other proteins in same PDB: d4lqua2, d4lqub2, d4lquc2, d4lqud2
    automated match to d3st2a_
    mutant

Details for d4lqub1

PDB Entry: 4lqu (more details), 1.6 Å

PDB Description: 1.60a resolution crystal structure of a superfolder green fluorescent protein (w57g) mutant
PDB Compounds: (B:) Green fluorescent protein

SCOPe Domain Sequences for d4lqub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lqub1 d.22.1.1 (B:2-231) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpgptlv
ttlgygvqcfsrypdhmkqhdffksampegyvqertisfkddgtyktraevkfegdtlvn
rielkgidfkedgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladh
yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagith

SCOPe Domain Coordinates for d4lqub1:

Click to download the PDB-style file with coordinates for d4lqub1.
(The format of our PDB-style files is described here.)

Timeline for d4lqub1: