Lineage for d4lhwc_ (4lhw C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846598Protein Rab8a [142293] (2 species)
  7. 1846599Species Human (Homo sapiens) [TaxId:9606] [254870] (4 PDB entries)
  8. 1846602Domain d4lhwc_: 4lhw C: [229856]
    automated match to d4lhvd_
    complexed with gnp, mg, mpd

Details for d4lhwc_

PDB Entry: 4lhw (more details), 1.55 Å

PDB Description: Crystal structure of Rab8 in its active GppNHp-bound form
PDB Compounds: (C:) Ras-related protein Rab-8A

SCOPe Domain Sequences for d4lhwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lhwc_ c.37.1.8 (C:) Rab8a {Human (Homo sapiens) [TaxId: 9606]}
dylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiwdta
gqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnkcdv
ndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdkk

SCOPe Domain Coordinates for d4lhwc_:

Click to download the PDB-style file with coordinates for d4lhwc_.
(The format of our PDB-style files is described here.)

Timeline for d4lhwc_: