SCOPe 2.05: Domain d4lhwe_: 4lhw E:

Lineage for d4lhwe_ (4lhw E:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab8a [142293] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [254870] (4 PDB entries)

8. Domain d4lhwe_: 4lhw E: [229854]
   automated match to d4lhvd_
   complexed with gnp, mg, mpd

Details for d4lhwe_

PDB Entry: 4lhw, 1.55 Å

PDB Description: Crystal structure of Rab8 in its active GppNHp-bound form

PDB Compounds: (E:) Ras-related protein Rab-8A

SCOPe Domain Sequences for d4lhwe_:

Sequence; same for both SEQRES and ATOM records:

>d4lhwe_ c.37.1.8 (E:) Rab8a {Human (Homo sapiens) [TaxId: 9606]}
dylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiwdta
gqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnkcdv
ndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdkk

Timeline for d4lhwe_:

• d4lhwe_ first appeared in SCOPe 2.03
  
• d4lhwe_ appears in SCOPe 2.04
  
• d4lhwe_ appears in SCOPe 2.06
  
• d4lhwe_ appears in the current release, SCOPe 2.08