SCOPe 2.08: Domain d4jgxb_: 4jgx B:

Lineage for d4jgxb_ (4jgx B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.106: SCP-like [55717] (1 superfamily)
   alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145

4. Superfamily d.106.1: SCP-like [55718] (5 families)

5. Family d.106.1.0: automated matches [191568] (1 protein)
   not a true family

6. Protein automated matches [190987] (4 species)
   not a true protein

7. Species Yarrowia lipolytica [TaxId:284591] [229842] (2 PDB entries)

8. Domain d4jgxb_: 4jgx B: [229843]
   automated match to d1ikta_
   complexed with cit, plm

Details for d4jgxb_

PDB Entry: 4jgx, 2.2 Å

PDB Description: The Structure of Sterol Carrier Protein 2 from the Yeast Yarrowia Lipolytica

PDB Compounds: (B:) fatty acid-binding protein

SCOPe Domain Sequences for d4jgxb_:

Sequence; same for both SEQRES and ATOM records:

>d4jgxb_ d.106.1.0 (B:) automated matches {Yarrowia lipolytica [TaxId: 284591]}
slkvdgftssiifdvirdglndpsqakqkaesikkanaiivfnlknkagkteswyldlkn
dgdvgkgnkspkgdadiqltlsddhfqqlvegkanaqrlfmtgklkvkgnvmkaaaiegi
lknaqnnl

Timeline for d4jgxb_:

• d4jgxb_ first appeared in SCOPe 2.03
  
• d4jgxb_ appears in SCOPe 2.07