![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.106: SCP-like [55717] (1 superfamily) alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145 |
![]() | Superfamily d.106.1: SCP-like [55718] (5 families) ![]() |
![]() | Family d.106.1.0: automated matches [191568] (1 protein) not a true family |
![]() | Protein automated matches [190987] (4 species) not a true protein |
![]() | Species Yarrowia lipolytica [TaxId:284591] [229842] (2 PDB entries) |
![]() | Domain d4jgxb_: 4jgx B: [229843] automated match to d1ikta_ complexed with cit, plm |
PDB Entry: 4jgx (more details), 2.2 Å
SCOPe Domain Sequences for d4jgxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jgxb_ d.106.1.0 (B:) automated matches {Yarrowia lipolytica [TaxId: 284591]} slkvdgftssiifdvirdglndpsqakqkaesikkanaiivfnlknkagkteswyldlkn dgdvgkgnkspkgdadiqltlsddhfqqlvegkanaqrlfmtgklkvkgnvmkaaaiegi lknaqnnl
Timeline for d4jgxb_: