Lineage for d4i2xc2 (4i2x C:108-214)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361253Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 2362347Domain d4i2xc2: 4i2x C:108-214 [229839]
    Other proteins in same PDB: d4i2xa1, d4i2xc1
    automated match to d3difc2
    complexed with cl, nag, zn

Details for d4i2xc2

PDB Entry: 4i2x (more details), 2.48 Å

PDB Description: crystal structure of signal regulatory protein gamma (sirp-gamma) in complex with fabox117
PDB Compounds: (C:) FabOX117 light chain

SCOPe Domain Sequences for d4i2xc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i2xc2 b.1.1.2 (C:108-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d4i2xc2:

Click to download the PDB-style file with coordinates for d4i2xc2.
(The format of our PDB-style files is described here.)

Timeline for d4i2xc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i2xc1