Lineage for d4i2xc1 (4i2x C:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756632Domain d4i2xc1: 4i2x C:1-107 [229837]
    Other proteins in same PDB: d4i2xa2, d4i2xb1, d4i2xb2, d4i2xc2, d4i2xd_
    automated match to d3difc1
    complexed with cl, nag, zn

Details for d4i2xc1

PDB Entry: 4i2x (more details), 2.48 Å

PDB Description: crystal structure of signal regulatory protein gamma (sirp-gamma) in complex with fabox117
PDB Compounds: (C:) FabOX117 light chain

SCOPe Domain Sequences for d4i2xc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i2xc1 b.1.1.0 (C:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divitqspkfmstsvgdrvsitckasqdvstavawfqqkpgqspklliysasyrytgvpd
rftgsgsgtdftftissvqaedlavyycqqhystpwtfgggtkleik

SCOPe Domain Coordinates for d4i2xc1:

Click to download the PDB-style file with coordinates for d4i2xc1.
(The format of our PDB-style files is described here.)

Timeline for d4i2xc1: