SCOPe 2.06: Domain d4iaaa_: 4iaa A:

Lineage for d4iaaa_ (4iaa A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Proto-oncogene serine/threonine-protein kinase Pim-1 [118133] (1 species)
   OPK group(?); PIM subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [118134] (99 PDB entries)
   Uniprot P11309 33-305 ! Uniprot P11309 32-308

8. Domain d4iaaa_: 4iaa A: [229836]
   automated match to d4k18a_
   complexed with rtz

Details for d4iaaa_

PDB Entry: 4iaa, 2.85 Å

PDB Description: Crystal structure of Ser/Thr kinase Pim1 in complex with thioridazine

PDB Compounds: (A:) Serine/threonine-protein kinase pim-1

SCOPe Domain Sequences for d4iaaa_:

Sequence; same for both SEQRES and ATOM records:

>d4iaaa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
lrpsdrptfeeiqnhpwmqdvllpqetaeihlh

Timeline for d4iaaa_:

• d4iaaa_ first appeared in SCOPe 2.03
  
• d4iaaa_ appears in SCOPe 2.05
  
• d4iaaa_ appears in SCOPe 2.07
  
• d4iaaa_ appears in the current release, SCOPe 2.08