Lineage for d4iaaa_ (4iaa A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2982873Protein Proto-oncogene serine/threonine-protein kinase Pim-1 [118133] (1 species)
    OPK group(?); PIM subfamily; serine/threonine kinase
  7. 2982874Species Human (Homo sapiens) [TaxId:9606] [118134] (118 PDB entries)
    Uniprot P11309 33-305 ! Uniprot P11309 32-308
  8. 2982985Domain d4iaaa_: 4iaa A: [229836]
    automated match to d4k18a_
    complexed with rtz

Details for d4iaaa_

PDB Entry: 4iaa (more details), 2.85 Å

PDB Description: Crystal structure of Ser/Thr kinase Pim1 in complex with thioridazine
PDB Compounds: (A:) Serine/threonine-protein kinase pim-1

SCOPe Domain Sequences for d4iaaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iaaa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
lrpsdrptfeeiqnhpwmqdvllpqetaeihlh

SCOPe Domain Coordinates for d4iaaa_:

Click to download the PDB-style file with coordinates for d4iaaa_.
(The format of our PDB-style files is described here.)

Timeline for d4iaaa_: