SCOPe 2.03: Domain d4irxa_: 4irx A:

Lineage for d4irxa_ (4irx A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (31 species)
   not a true protein

7. Species Caulobacter crescentus [TaxId:190650] [229832] (1 PDB entry)

8. Domain d4irxa_: 4irx A: [229834]
   automated match to d2fn8a_
   complexed with ins

Details for d4irxa_

PDB Entry: 4irx, 1.45 Å

PDB Description: crystal structure of caulobacter myo-inositol binding protein bound to myo-inositol

PDB Compounds: (A:) Sugar ABC transporter, periplasmic sugar-binding protein

SCOPe Domain Sequences for d4irxa_:

Sequence; same for both SEQRES and ATOM records:

>d4irxa_ c.93.1.0 (A:) automated matches {Caulobacter crescentus [TaxId: 190650]}
glvprgshmevvvsfndlsqpffvamrreledeaaklgvkvqvldaqnnsskqisdlqaa
avqgakvvivaptdskalagaaddlveqgvavisvdrniaggktavphvgadnvaggram
adwvvktypagarvvvitndpgssssiervkgvhdglaaggpafkivteqtanskrdqal
tvtqniltsmrdtppdvilclnddmamgaleavraagldsakvkvigfdaipealarika
gemvatveqnpglqirtalrqavdkiksgaalksvslkpvlitsgnlteasrigem

Timeline for d4irxa_:

• d4irxa_ is new in SCOPe 2.03-stable
  
• d4irxa_ appears in SCOPe 2.04
  
• d4irxa_ appears in the current release, SCOPe 2.08, called d4irxa1