Lineage for d4ihka_ (4ihk A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468413Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2468414Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2468636Family c.62.1.0: automated matches [191586] (1 protein)
    not a true family
  6. 2468637Protein automated matches [191045] (3 species)
    not a true protein
  7. 2468654Species Mouse (Mus musculus) [TaxId:10090] [229830] (2 PDB entries)
  8. 2468656Domain d4ihka_: 4ihk A: [229831]
    automated match to d1na5a_

Details for d4ihka_

PDB Entry: 4ihk (more details), 1.2 Å

PDB Description: Crystal structure of the Collagen VI alpha3 N5 domain R1061Q
PDB Compounds: (A:) Collagen alpha3(VI)

SCOPe Domain Sequences for d4ihka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ihka_ c.62.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sgekdvvflidgsegvrsgfpllkdfvqrvvesldvgpdqvrvalvqysdrtrpefylns
hmdqqgvisairrltllggptpntgaalefvlrniltsstgsriaegvpqllivltaeps
gddvrgpsvvlkqggavpigigignadisemqtisfipdfavaiptfrelgtiqqviser
viqlnreelsslk

SCOPe Domain Coordinates for d4ihka_:

Click to download the PDB-style file with coordinates for d4ihka_.
(The format of our PDB-style files is described here.)

Timeline for d4ihka_: