![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.62.1: vWA-like [53300] (6 families) ![]() |
![]() | Family c.62.1.0: automated matches [191586] (1 protein) not a true family |
![]() | Protein automated matches [191045] (3 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [229830] (3 PDB entries) |
![]() | Domain d4ihka_: 4ihk A: [229831] automated match to d1na5a_ |
PDB Entry: 4ihk (more details), 1.2 Å
SCOPe Domain Sequences for d4ihka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ihka_ c.62.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} sgekdvvflidgsegvrsgfpllkdfvqrvvesldvgpdqvrvalvqysdrtrpefylns hmdqqgvisairrltllggptpntgaalefvlrniltsstgsriaegvpqllivltaeps gddvrgpsvvlkqggavpigigignadisemqtisfipdfavaiptfrelgtiqqviser viqlnreelsslk
Timeline for d4ihka_: