| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) ![]() |
| Family a.91.1.0: automated matches [191379] (1 protein) not a true family |
| Protein automated matches [190464] (3 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [229827] (1 PDB entry) |
| Domain d4igua1: 4igu A:13-140 [229829] Other proteins in same PDB: d4igua2, d4igua3, d4igub2, d4igub3 automated match to d2af0a_ complexed with cl, edo, na |
PDB Entry: 4igu (more details), 1.9 Å
SCOPe Domain Sequences for d4igua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4igua1 a.91.1.0 (A:13-140) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qptleeirswgksfdklmkstagrkvfqnflrsefseenilfwlacedlkkenspelvee
karliyedyisilsprevsldsrvreivnrnmieptthtfdeaqiqiytlmhrdsyprfl
nsqkfktl
Timeline for d4igua1: