SCOPe 2.05: Domain d4if2a_: 4if2 A:

Lineage for d4if2a_ (4if2 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (22 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [229823] (1 PDB entry)

8. Domain d4if2a_: 4if2 A: [229824]
   automated match to d2vc7a_
   complexed with zn

Details for d4if2a_

PDB Entry: 4if2, 2.27 Å

PDB Description: structure of the phosphotriesterase from mycobacterium tuberculosis

PDB Compounds: (A:) phosphotriesterase homology protein

SCOPe Domain Sequences for d4if2a_:

Sequence; same for both SEQRES and ATOM records:

>d4if2a_ c.1.9.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
pelntargpidtadlgvtlmhehvfimtteiaqnypeawgdedkrvagaiarlgelkarg
vdtivdltviglgryipriarvaaatelnivvatglytyndvpfyfhylgpgaqldgpei
mtdmfvrdiehgiadtgikagilkcatdepgltpgvervlravaqahkrtgapisththa
glrrgldqqrifaeegvdlsrvvighcgdstdvgyleeliaagsylgmdrfgvdvispfq
drvnivarmcerghadkmvlshdaccyfdalpeelvpvampnwhylhihndvipalkqhg
vtdeqlhtmlvdnprriferqggy

Timeline for d4if2a_:

• d4if2a_ first appeared in SCOPe 2.03
  
• d4if2a_ appears in SCOPe 2.04
  
• d4if2a_ appears in SCOPe 2.06
  
• d4if2a_ appears in the current release, SCOPe 2.08