SCOPe 2.08: Domain d4ifta_: 4ift A:

Lineage for d4ifta_ (4ift A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (55 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [229821] (4 PDB entries)

8. Domain d4ifta_: 4ift A: [229822]
   automated match to d3pdwa_
   mutant

Details for d4ifta_

PDB Entry: 4ift, 2 Å

PDB Description: crystal structure of double mutant thermostable nppase from geobacillus stearothermophilus

PDB Compounds: (A:) Thermostable NPPase

SCOPe Domain Sequences for d4ifta_:

Sequence; same for both SEQRES and ATOM records:

>d4ifta_ c.108.1.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
mrkyngylidldgtmyrgteridaasgfikelnrlhipylfvtnnstrtpeqvadklvsl
dipatpeqiftssmatanyvydldqnamiyfigeeglykalkekgfsfadenadvvivgl
drevtyeklavaclavrngaklistngdlvlpterglmpgngaftalishstqvkatfvg
kpepiimeqalkvlgtnknetimvgdnydtdilagiragldtllvhtgvttveklkeykq
qptysmkslddwkfl

Timeline for d4ifta_:

• d4ifta_ first appeared in SCOPe 2.03
  
• d4ifta_ appears in SCOPe 2.07