Lineage for d4i2vc_ (4i2v C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2888268Protein Uridine phosphorylase [53176] (6 species)
  7. 2888632Species Yersinia pseudotuberculosis [TaxId:633] [229814] (2 PDB entries)
  8. 2888637Domain d4i2vc_: 4i2v C: [229816]
    automated match to d1zl2a_

Details for d4i2vc_

PDB Entry: 4i2v (more details), 2.12 Å

PDB Description: X-ray structure of the unliganded uridine phosphorylase from Yersinia pseudotuberculosis at 2.12A resolution
PDB Compounds: (C:) Uridine phosphorylase

SCOPe Domain Sequences for d4i2vc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i2vc_ c.56.2.1 (C:) Uridine phosphorylase {Yersinia pseudotuberculosis [TaxId: 633]}
sdvfhlgltkndlqgatlaivpgdpqrvekiaklmdnpvhlashreftswraeldgkavi
vcstgiggpstsiaveelaqlgvrtflrigttgaiqphinvgdvlvttaavrldgaslhf
apmefpavadfscttalvnaaksvgatthigitassdtfypgqerydtfsgrvvrhfkgs
meewqsmgvmnyemesatlltmcasqglragmvagvivnrtqqeipneetmkateshavk
ivveaarhll

SCOPe Domain Coordinates for d4i2vc_:

Click to download the PDB-style file with coordinates for d4i2vc_.
(The format of our PDB-style files is described here.)

Timeline for d4i2vc_: