SCOPe 2.08: Domain d4ft8a1: 4ft8 A:8-137

Lineage for d4ft8a1 (4ft8 A:8-137)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species)

7. Species Escherichia coli [TaxId:562] [51212] (32 PDB entries)

8. Domain d4ft8a1: 4ft8 A:8-137 [229808]
   Other proteins in same PDB: d4ft8a2, d4ft8b2
   automated match to d1i5zb2
   complexed with cmp, co, so4

Details for d4ft8a1

PDB Entry: 4ft8, 1.97 Å

PDB Description: E. coli Catabolite Activator Protein with Cobalt and Sulfate Ligands

PDB Compounds: (A:) Catabolite gene activator

SCOPe Domain Sequences for d4ft8a1:

Sequence; same for both SEQRES and ATOM records:

>d4ft8a1 b.82.3.2 (A:8-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]}
dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
sekvgnlafl

Timeline for d4ft8a1:

• d4ft8a1 first appeared in SCOPe 2.03
  
• d4ft8a1 appears in SCOPe 2.07