Lineage for d4cboa_ (4cbo A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1318222Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1318223Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1318445Family b.47.1.2: Eukaryotic proteases [50514] (48 protein domains)
  6. 1318940Protein Factor D [50563] (1 species)
  7. 1318941Species Human (Homo sapiens) [TaxId:9606] [50564] (12 PDB entries)
  8. 1318945Domain d4cboa_: 4cbo A: [229806]
    automated match to d2xwaa_

Details for d4cboa_

PDB Entry: 4cbo (more details), 1.8 Å

PDB Description: crystal structure of complement factor d mutant r202a after ensemble refinement
PDB Compounds: (A:) complement factor d

SCOPe Domain Sequences for d4cboa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cboa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]}
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvtsgsavcgnrkkpgiytrvasyaawidsvla

SCOPe Domain Coordinates for d4cboa_:

Click to download the PDB-style file with coordinates for d4cboa_.
(The format of our PDB-style files is described here.)

Timeline for d4cboa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4cbob_