Lineage for d4cfnb1 (4cfn B:177-309)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2331190Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2331191Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2331192Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2331205Protein Cyclin A [47956] (2 species)
  7. 2331247Species Human (Homo sapiens) [TaxId:9606] [47957] (86 PDB entries)
    Uniprot P20248 175-432
  8. 2331398Domain d4cfnb1: 4cfn B:177-309 [229787]
    Other proteins in same PDB: d4cfna1, d4cfna2, d4cfnc1, d4cfnc2
    automated match to d1h1pb1
    complexed with dtt, jym

Details for d4cfnb1

PDB Entry: 4cfn (more details), 2.2 Å

PDB Description: Structure-based design of C8-substituted O6-cyclohexylmethoxyguanine CDK1 and 2 inhibitors.
PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d4cfnb1:

Sequence, based on SEQRES records: (download)

>d4cfnb1 a.74.1.1 (B:177-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
dyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlav
nyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmeh
lvlkvltfdlaap

Sequence, based on observed residues (ATOM records): (download)

>d4cfnb1 a.74.1.1 (B:177-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
dyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlav
nyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyittytkkqvlrmehlv
lkvltfdlaap

SCOPe Domain Coordinates for d4cfnb1:

Click to download the PDB-style file with coordinates for d4cfnb1.
(The format of our PDB-style files is described here.)

Timeline for d4cfnb1: