SCOPe 2.05: Domain d4br6d1: 4br6 D:1-83

Lineage for d4br6d1 (4br6 D:1-83)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (31 species)
   not a true protein

7. Species Chaetomium thermophilum [TaxId:209285] [229762] (1 PDB entry)

8. Domain d4br6d1: 4br6 D:1-83 [229776]
   Other proteins in same PDB: d4br6a2, d4br6b2, d4br6c2, d4br6d2
   automated match to d3qvna1
   complexed with gol, mn3, na

Details for d4br6d1

PDB Entry: 4br6, 2 Å

PDB Description: crystal structure of chaetomium thermophilum mnsod

PDB Compounds: (D:) superoxide dismutase

SCOPe Domain Sequences for d4br6d1:

Sequence; same for both SEQRES and ATOM records:

>d4br6d1 a.2.11.0 (D:1-83) automated matches {Chaetomium thermophilum [TaxId: 209285]}
katlpdlkydygalepyisarimelhhskhhqtyvnglnsaleataeaeakgdftkaasl
apllnfhggghlnhtlfwenlap

Timeline for d4br6d1:

• d4br6d1 first appeared in SCOPe 2.03
  
• d4br6d1 appears in SCOPe 2.04
  
• d4br6d1 appears in SCOPe 2.06
  
• d4br6d1 appears in the current release, SCOPe 2.08