Class a: All alpha proteins [46456] (286 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (31 species) not a true protein |
Species Chaetomium thermophilum [TaxId:209285] [229762] (1 PDB entry) |
Domain d4br6d1: 4br6 D:1-83 [229776] Other proteins in same PDB: d4br6a2, d4br6b2, d4br6c2, d4br6d2 automated match to d3qvna1 complexed with gol, mn3, na |
PDB Entry: 4br6 (more details), 2 Å
SCOPe Domain Sequences for d4br6d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4br6d1 a.2.11.0 (D:1-83) automated matches {Chaetomium thermophilum [TaxId: 209285]} katlpdlkydygalepyisarimelhhskhhqtyvnglnsaleataeaeakgdftkaasl apllnfhggghlnhtlfwenlap
Timeline for d4br6d1: