Lineage for d4br6c2 (4br6 C:84-197)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647686Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1647687Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1647961Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 1647962Protein automated matches [226860] (25 species)
    not a true protein
  7. 1648003Species Chaetomium thermophilum [TaxId:209285] [229770] (1 PDB entry)
  8. 1648006Domain d4br6c2: 4br6 C:84-197 [229773]
    Other proteins in same PDB: d4br6a1, d4br6b1, d4br6c1, d4br6d1
    automated match to d3qvna2
    complexed with gol, mn3, na

Details for d4br6c2

PDB Entry: 4br6 (more details), 2 Å

PDB Description: crystal structure of chaetomium thermophilum mnsod
PDB Compounds: (C:) superoxide dismutase

SCOPe Domain Sequences for d4br6c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4br6c2 d.44.1.0 (C:84-197) automated matches {Chaetomium thermophilum [TaxId: 209285]}
asregggepdgalkkaieadfgsfetfrkqmnaaltgiqgsgwawlakdkdsgnlaivtr
anqdpvtgqlvplmgidawehayylqyenrkaeyfeaiwnvinwktvaqrfeka

SCOPe Domain Coordinates for d4br6c2:

Click to download the PDB-style file with coordinates for d4br6c2.
(The format of our PDB-style files is described here.)

Timeline for d4br6c2: