Lineage for d4br6c1 (4br6 C:1-83)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1718782Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1719057Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1719324Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 1719325Protein automated matches [226859] (31 species)
    not a true protein
  7. 1719383Species Chaetomium thermophilum [TaxId:209285] [229762] (1 PDB entry)
  8. 1719386Domain d4br6c1: 4br6 C:1-83 [229769]
    Other proteins in same PDB: d4br6a2, d4br6b2, d4br6c2, d4br6d2
    automated match to d3qvna1
    complexed with gol, mn3, na

Details for d4br6c1

PDB Entry: 4br6 (more details), 2 Å

PDB Description: crystal structure of chaetomium thermophilum mnsod
PDB Compounds: (C:) superoxide dismutase

SCOPe Domain Sequences for d4br6c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4br6c1 a.2.11.0 (C:1-83) automated matches {Chaetomium thermophilum [TaxId: 209285]}
katlpdlkydygalepyisarimelhhskhhqtyvnglnsaleataeaeakgdftkaasl
apllnfhggghlnhtlfwenlap

SCOPe Domain Coordinates for d4br6c1:

Click to download the PDB-style file with coordinates for d4br6c1.
(The format of our PDB-style files is described here.)

Timeline for d4br6c1: