SCOPe 2.08: Domain d4bjhb1: 4bjh B:1-142

Lineage for d4bjhb1 (4bjh B:1-142)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (26 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:63363] [229765] (2 PDB entries)

8. Domain d4bjhb1: 4bjh B:1-142 [229766]
   automated match to d3r7da1
   complexed with ba, dor, edo, pal, po4, zn

Details for d4bjhb1

PDB Entry: 4bjh, 2.2 Å

PDB Description: crystal structure of the aquifex reactor complex formed by dihydroorotase (h180a, h232a) with dihydroorotate and aspartate transcarbamoylase with n-(phosphonacetyl)-l-aspartate (pala)

PDB Compounds: (B:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d4bjhb1:

Sequence; same for both SEQRES and ATOM records:

>d4bjhb1 c.78.1.0 (B:1-142) automated matches {Aquifex aeolicus [TaxId: 63363]}
mrslissldltreeveeilkyakefkegkeetikasavlffsepstrtrlsfekaarelg
ietylvsgsesstvkgesffdtlktfeglgfdyvvfrvpfvffpykeivkslnlrlvnag
dgthqhpsqglidfftikehfg

Timeline for d4bjhb1:

• d4bjhb1 first appeared in SCOPe 2.03
  
• d4bjhb1 appears in SCOPe 2.07