Lineage for d4cadj2 (4cad J:108-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760295Domain d4cadj2: 4cad J:108-212 [229759]
    Other proteins in same PDB: d4cadb_, d4cade_, d4cadh_, d4cadk_
    automated match to d4cadg2
    complexed with bog, lmt

Details for d4cadj2

PDB Entry: 4cad (more details), 2.5 Å

PDB Description: mechanism of farnesylated caax protein processing by the integral membrane protease rce1
PDB Compounds: (J:) antibody fab fragment light chain

SCOPe Domain Sequences for d4cadj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cadj2 b.1.1.0 (J:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d4cadj2:

Click to download the PDB-style file with coordinates for d4cadj2.
(The format of our PDB-style files is described here.)

Timeline for d4cadj2: