SCOP 1.61: Domain d1ilue_: 1ilu E:

Lineage for d1ilue_ (1ilu E:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (32 PDB entries)

8. Domain d1ilue_: 1ilu E: [22975]

Details for d1ilue_

PDB Entry: 1ilu, 2.3 Å

PDB Description: x-ray crystal structure the two site-specific mutants ile7ser and phe110ser of azurin from pseudomonas aeruginosa

SCOP Domain Sequences for d1ilue_:

Sequence; same for both SEQRES and ATOM records:

>d1ilue_ b.6.1.1 (E:) Azurin {Pseudomonas aeruginosa}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymsfctfpghsal
mkgtltlk

Timeline for d1ilue_:

• d1ilue_ first appeared (with stable ids) in SCOP 1.55
  
• d1ilue_ appears in SCOP 1.59
  
• d1ilue_ appears in SCOP 1.63
  
• d1ilue_ appears in the current release, SCOPe 2.08