Lineage for d3wi2a_ (3wi2 A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
multihelical; consists of two different alpha-helical bundlesSuperfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) 
Family a.211.1.0: automated matches [191566] (1 protein)
not a true familyProtein automated matches [190983] (6 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [188676] (86 PDB entries) 
Domain d3wi2a_: 3wi2 A: [229748]
automated match to d3b2ra_
complexed with mg, p98, zn
Details for d3wi2a_
PDB Entry: 3wi2 (more details), 2.26 Å
PDB Description: crystal structure of pde10a in complex with inhibitor
PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10ASCOPe Domain Sequences for d3wi2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wi2a_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfele
klcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdld
hrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleii
rkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtk
ltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilp
ptepllkacrdnlsqwekvirgee
SCOPe Domain Coordinates for d3wi2a_:
Click to download the PDB-style file with coordinates for d3wi2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3wi2a_:
- d3wi2a_ first appeared in SCOPe 2.03
- d3wi2a_ appears in SCOPe 2.04
- d3wi2a_ is called d3wi2a1 in SCOPe 2.06
- d3wi2a_ appears in the current release, SCOPe 2.08, called d3wi2a1
View in 3D
