SCOPe 2.03: Domain d3wbmb_: 3wbm B:

Lineage for d3wbmb_ (3wbm B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.6: AlbA-like [82704] (3 families)

5. Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins)

6. Protein automated matches [190221] (4 species)
   not a true protein

7. Species Sulfolobus shibatae [TaxId:2286] [229739] (1 PDB entry)

8. Domain d3wbmb_: 3wbm B: [229743]
   automated match to d2bkya_
   protein/DNA complex; protein/RNA complex

Details for d3wbmb_

PDB Entry: 3wbm, 2 Å

PDB Description: crystal structure of protein-rna complex

PDB Compounds: (B:) DNA/RNA-binding protein alba 1

SCOPe Domain Sequences for d3wbmb_:

Sequence, based on SEQRES records:

>d3wbmb_ d.68.6.1 (B:) automated matches {Sulfolobus shibatae [TaxId: 2286]}
tpsnvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrflpdkie
ikeirvgsqvvtsqdgrqsrvstieiairkk

Sequence, based on observed residues (ATOM records):

>d3wbmb_ d.68.6.1 (B:) automated matches {Sulfolobus shibatae [TaxId: 2286]}
tpsnvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrflpdkie
ikeirvgsqvvsrvstieiairkk

Timeline for d3wbmb_:

• d3wbmb_ is new in SCOPe 2.03-stable
  
• d3wbmb_ appears in SCOPe 2.04
  
• d3wbmb_ appears in the current release, SCOPe 2.08