![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
![]() | Superfamily d.68.6: AlbA-like [82704] (3 families) ![]() |
![]() | Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins) |
![]() | Protein automated matches [190221] (4 species) not a true protein |
![]() | Species Sulfolobus shibatae [TaxId:2286] [229739] (2 PDB entries) |
![]() | Domain d3wbmc_: 3wbm C: [229740] automated match to d2bkya_ protein/DNA complex; protein/RNA complex |
PDB Entry: 3wbm (more details), 2 Å
SCOPe Domain Sequences for d3wbmc_:
Sequence, based on SEQRES records: (download)
>d3wbmc_ d.68.6.1 (C:) automated matches {Sulfolobus shibatae [TaxId: 2286]} tptpsnvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrflpdk ieikeirvgsqvvtsqdgrqsrvstieiairkk
>d3wbmc_ d.68.6.1 (C:) automated matches {Sulfolobus shibatae [TaxId: 2286]} tptpsnvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrflpdk ieikeirvgsqvvsrvstieiairkk
Timeline for d3wbmc_: