Lineage for d3wbmc_ (3wbm C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957073Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2957430Superfamily d.68.6: AlbA-like [82704] (3 families) (S)
  5. 2957431Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins)
  6. 2957450Protein automated matches [190221] (4 species)
    not a true protein
  7. 2957459Species Sulfolobus shibatae [TaxId:2286] [229739] (2 PDB entries)
  8. 2957462Domain d3wbmc_: 3wbm C: [229740]
    automated match to d2bkya_
    protein/DNA complex; protein/RNA complex

Details for d3wbmc_

PDB Entry: 3wbm (more details), 2 Å

PDB Description: crystal structure of protein-rna complex
PDB Compounds: (C:) DNA/RNA-binding protein alba 1

SCOPe Domain Sequences for d3wbmc_:

Sequence, based on SEQRES records: (download)

>d3wbmc_ d.68.6.1 (C:) automated matches {Sulfolobus shibatae [TaxId: 2286]}
tptpsnvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrflpdk
ieikeirvgsqvvtsqdgrqsrvstieiairkk

Sequence, based on observed residues (ATOM records): (download)

>d3wbmc_ d.68.6.1 (C:) automated matches {Sulfolobus shibatae [TaxId: 2286]}
tptpsnvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrflpdk
ieikeirvgsqvvsrvstieiairkk

SCOPe Domain Coordinates for d3wbmc_:

Click to download the PDB-style file with coordinates for d3wbmc_.
(The format of our PDB-style files is described here.)

Timeline for d3wbmc_: