SCOPe 2.08: Domain d3w2ya_: 3w2y A:

Lineage for d3w2ya_ (3w2y A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (4 families)

5. Family d.151.1.0: automated matches [191468] (1 protein)
   not a true family

6. Protein automated matches [190734] (14 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:187420] [229730] (15 PDB entries)

8. Domain d3w2ya_: 3w2y A: [229731]
   automated match to d1vyba_
   complexed with fmt, mg, peg; mutant

Details for d3w2ya_

PDB Entry: 3w2y, 1.9 Å

PDB Description: crystal structure of dna uridine endonuclease mth212 mutant w205s

PDB Compounds: (A:) exodeoxyribonuclease

SCOPe Domain Sequences for d3w2ya_:

Sequence; same for both SEQRES and ATOM records:

>d3w2ya_ d.151.1.0 (A:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
tvlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsfft
paerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmseer
lkyklefydafledvnrerdsgrnviicgdfntahreidlarpkensnvsgflpverawi
dkfiengyvdtfrmfnsdpgqytswsyrtrarernvgwrldyffvneefkgkvkrswils
dvmgsdhcpigleiel

Timeline for d3w2ya_:

• d3w2ya_ first appeared in SCOPe 2.03
  
• d3w2ya_ appears in SCOPe 2.07