SCOPe 2.06: Domain d4nkgb_: 4nkg B:

Lineage for d4nkgb_ (4nkg B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.6: HR1 repeat [46585] (1 family)

5. Family a.2.6.1: HR1 repeat [46586] (2 proteins)
   protein kinase effector domain
   this is a repeat family; one repeat unit is 1urf A:122-199 found in domain

6. Protein automated matches [229723] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [229724] (1 PDB entry)

8. Domain d4nkgb_: 4nkg B: [229725]
   automated match to d1urfa_
   complexed with hez

Details for d4nkgb_

PDB Entry: 4nkg, 2.9 Å

PDB Description: Crystal structure of SspH1 LRR domain in complex PKN1 HR1b domain

PDB Compounds: (B:) Serine/threonine-protein kinase N1

SCOPe Domain Sequences for d4nkgb_:

Sequence; same for both SEQRES and ATOM records:

>d4nkgb_ a.2.6.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lsrvaglekqlaielkvkqgaenmiqtysngstkdrkllltaqqmlqdsktkidiirmql
rralqa

Timeline for d4nkgb_:

• d4nkgb_ first appeared in SCOPe 2.03
  
• d4nkgb_ appears in SCOPe 2.05
  
• d4nkgb_ appears in SCOPe 2.07
  
• d4nkgb_ appears in the current release, SCOPe 2.08