SCOPe 2.08: Domain d4nc1e1: 4nc1 E:2-123

Lineage for d4nc1e1 (4nc1 E:2-123)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d4nc1e1: 4nc1 E:2-123 [229722]
   Other proteins in same PDB: d4nc1e2, d4nc1f2
   automated match to d3qxta_

Details for d4nc1e1

PDB Entry: 4nc1, 2.61 Å

PDB Description: Crystal Structure of TcdA-A2 Bound to A20.1 VHH and A26.8 VHH

PDB Compounds: (E:) a26.8 vhh

SCOPe Domain Sequences for d4nc1e1:

Sequence; same for both SEQRES and ATOM records:

>d4nc1e1 b.1.1.1 (E:2-123) automated matches {Llama (Lama glama) [TaxId: 9844]}
vkleesggglvqaggslrlscaasertfsrypvawfrqapgaerefvavisstgtstyya
dsvkgrftisrdnakvtvylqmnnlkredtavyfcavnsqrtrlqdpneydywgqgtqvt
vs

Timeline for d4nc1e1:

• d4nc1e1 first appeared in SCOPe 2.03, called d4nc1e_
  
• d4nc1e1 appears in SCOPe 2.07