Lineage for d4nbzd_ (4nbz D:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1296770Species Llama (Lama glama) [TaxId:9844] [189241] (4 PDB entries)
  8. 1296772Domain d4nbzd_: 4nbz D: [229717]
    automated match to d1oauh_

Details for d4nbzd_

PDB Entry: 4nbz (more details), 1.75 Å

PDB Description: Crystal Structure of TcdA-A1 Bound to A26.8 VHH
PDB Compounds: (D:) a26.8 vhh

SCOPe Domain Sequences for d4nbzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nbzd_ b.1.1.0 (D:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vkleesggglvqaggslrlscaasertfsrypvawfrqapgaerefvavisstgtstyya
dsvkgrftisrdnakvtvylqmnnlkredtavyfcavnsqrtrlqdpneydywgqgtqvt
vss

SCOPe Domain Coordinates for d4nbzd_:

Click to download the PDB-style file with coordinates for d4nbzd_.
(The format of our PDB-style files is described here.)

Timeline for d4nbzd_: