Lineage for d4n5ma_ (4n5m A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848232Species Ralstonia eutropha [TaxId:381666] [229715] (8 PDB entries)
  8. 2848233Domain d4n5ma_: 4n5m A: [229716]
    automated match to d1fmca_
    complexed with caa, gol

Details for d4n5ma_

PDB Entry: 4n5m (more details), 1.34 Å

PDB Description: Crystal structure of (R)-3-hydroxybutyryl-CoA dehydrogenase from Ralstonia eutropha in complexed with acetoacetyl-CoA
PDB Compounds: (A:) Acetoacetyl-CoA reductase

SCOPe Domain Sequences for d4n5ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n5ma_ c.2.1.0 (A:) automated matches {Ralstonia eutropha [TaxId: 381666]}
mtqriayvtggmggigtaicqrlakdgfrvvagcgpnsprrekwleqqkalgfdfiaseg
nvadwdstktafdkvksevgevdvlinnagitrdvvfrkmtradwdavidtnltslfnvt
kqvidgmadrgwgrivnissvngqkgqfgqtnystakaglhgftmalaqevatkgvtvnt
vspgyiatdmvkairqdvldkivatipvkrlglpeeiasicawlsseesgfstgadfsln
gglhmg

SCOPe Domain Coordinates for d4n5ma_:

Click to download the PDB-style file with coordinates for d4n5ma_.
(The format of our PDB-style files is described here.)

Timeline for d4n5ma_: