SCOPe 2.08: Domain d4n6aa_: 4n6a A:

Lineage for d4n6aa_ (4n6a A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (36 species)
   not a true protein

7. Species Soybean (Glycine max) [TaxId:3847] [228990] (3 PDB entries)

8. Domain d4n6aa_: 4n6a A: [229712]
   automated match to d4n69a_
   complexed with po4

Details for d4n6aa_

PDB Entry: 4n6a, 1.75 Å

PDB Description: Soybean Serine Acetyltransferase Apoenzyme

PDB Compounds: (A:) Serine Acetyltransferase Apoenzyme

SCOPe Domain Sequences for d4n6aa_:

Sequence; same for both SEQRES and ATOM records:

>d4n6aa_ b.81.1.0 (A:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
pdeegwvwgqikaearrdaesepalasylystilshsslerslsfhlgnklcsstllstl
lydlflnafssdpslrsaavadlraarerdpacvsyshcllnykgflacqahrvahllwr
qsrrplalalhsrianvfavdihpaarigkgilfdhatgvvvgetavignnvsilhhvtl
ggtgkvggdrhpkigdgvligagatilgnikigegakvgagsvvlidvpprttavgnpar
lv

Timeline for d4n6aa_:

• d4n6aa_ first appeared in SCOPe 2.03
  
• d4n6aa_ appears in SCOPe 2.07