Lineage for d4n0wc_ (4n0w C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896011Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2896366Protein automated matches [190152] (25 species)
    not a true protein
  7. 2896383Species Burkholderia cenocepacia [TaxId:216591] [229698] (4 PDB entries)
  8. 2896388Domain d4n0wc_: 4n0w C: [229707]
    Other proteins in same PDB: d4n0wa2
    automated match to d3gbxa_
    complexed with plp, so4

Details for d4n0wc_

PDB Entry: 4n0w (more details), 1.65 Å

PDB Description: X-ray crystal structure of a serine hydroxymethyltransferase from Burkholderia cenocepacia with covalently attached pyridoxal phosphate
PDB Compounds: (C:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d4n0wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n0wc_ c.67.1.4 (C:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
mfdraqstianvdpeifaaieqenrrqedhieliasenytspavmaaqgsqltnkyaegy
pgkryyggceyvdvveqlaidrvkqlfgaeaanvqpnsgsqanqgvffamlkpgdtimgm
slahgghlthgspvnmsgkwfnvvsyglnenedidydaaeklanehkpklivagasafal
kidferlakiaksvgaylmvdmahyagliaagvypnpvphadfvtttthkslrgprggvi
lmkaeyekpinsaifpgiqggplmhviaakavafkealspefkeyqqkvvenarvlaetl
vkrglrivsgrteshvmlvdlrakhitgkaaeaalgaahitvnknaipndpekpfvtsgi
rlgspamttrgfgpaeaeqvgnliadvlenpedaatiervraqvaeltkrfpvyr

SCOPe Domain Coordinates for d4n0wc_:

Click to download the PDB-style file with coordinates for d4n0wc_.
(The format of our PDB-style files is described here.)

Timeline for d4n0wc_: