SCOPe 2.08: Domain d4mu7b1: 4mu7 B:254-345

Lineage for d4mu7b1 (4mu7 B:254-345)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein automated matches [190700] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187840] (49 PDB entries)

8. Domain d4mu7b1: 4mu7 B:254-345 [229704]
   Other proteins in same PDB: d4mu7b2
   automated match to d4hy4b_
   complexed with 2dy, zn

Details for d4mu7b1

PDB Entry: 4mu7, 1.79 Å

PDB Description: Crystal structure of cIAP1 BIR3 bound to T3450325

PDB Compounds: (B:) Baculoviral IAP repeat-containing protein 2

SCOPe Domain Sequences for d4mu7b1:

Sequence; same for both SEQRES and ATOM records:

>d4mu7b1 g.52.1.1 (B:254-345) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesg
ddpwvehakwfprceflirmkgqefvdeiqgr

Timeline for d4mu7b1:

• d4mu7b1 first appeared in SCOPe 2.03, called d4mu7b_
  
• d4mu7b1 appears in SCOPe 2.07