SCOPe 2.04: Domain d4mtib_: 4mti B:

Lineage for d4mtib_ (4mti B:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein automated matches [190700] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187840] (25 PDB entries)

8. Domain d4mtib_: 4mti B: [229703]
   automated match to d4hy4a_
   complexed with 2dx, zn

Details for d4mtib_

PDB Entry: 4mti, 2.15 Å

PDB Description: Crystal structure of cIAP1 BIR3 bound to T3258042

PDB Compounds: (B:) Baculoviral IAP repeat-containing protein 2

SCOPe Domain Sequences for d4mtib_:

Sequence; same for both SEQRES and ATOM records:

>d4mtib_ g.52.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesgddp
wvehakwfprceflirmkgqefvdeiqgry

Timeline for d4mtib_:

• d4mtib_ first appeared in SCOPe 2.03
  
• d4mtib_ appears in SCOPe 2.05
  
• d4mtib_ appears in the current release, SCOPe 2.08