SCOPe 2.06: Domain d4mtia1: 4mti A:254-346

Lineage for d4mtia1 (4mti A:254-346)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein automated matches [190700] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187840] (41 PDB entries)

8. Domain d4mtia1: 4mti A:254-346 [229702]
   Other proteins in same PDB: d4mtia2
   automated match to d4hy4b_
   complexed with 2dx, zn

Details for d4mtia1

PDB Entry: 4mti, 2.15 Å

PDB Description: Crystal structure of cIAP1 BIR3 bound to T3258042

PDB Compounds: (A:) Baculoviral IAP repeat-containing protein 2

SCOPe Domain Sequences for d4mtia1:

Sequence; same for both SEQRES and ATOM records:

>d4mtia1 g.52.1.1 (A:254-346) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesg
ddpwvehakwfprceflirmkgqefvdeiqgry

Timeline for d4mtia1:

• d4mtia1 first appeared in SCOPe 2.03, called d4mtia_
  
• d4mtia1 was called d4mtia_ in SCOPe 2.05
  
• d4mtia1 appears in SCOPe 2.07
  
• d4mtia1 appears in the current release, SCOPe 2.08