Lineage for d1ezld_ (1ezl D:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 10906Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins)
  6. 10917Protein Azurin [49530] (6 species)
  7. 10946Species Pseudomonas aeruginosa [TaxId:287] [49533] (22 PDB entries)
  8. 10980Domain d1ezld_: 1ezl D: [22970]

Details for d1ezld_

PDB Entry: 1ezl (more details), 2 Å

PDB Description: crystal structure of the disulphide bond-deficient azurin mutant c3a/c26a: how important is the s-s bond for folding and stability?

SCOP Domain Sequences for d1ezld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezld_ b.6.1.1 (D:) Azurin {Pseudomonas aeruginosa}
aeasvdiqgndqmqfntnaitvdksakqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

SCOP Domain Coordinates for d1ezld_:

Click to download the PDB-style file with coordinates for d1ezld_.
(The format of our PDB-style files is described here.)

Timeline for d1ezld_: