Lineage for d4mgha4 (4mgh A:430-616)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1432632Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 1432633Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 1432634Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins)
  6. 1432644Protein FGAM synthase PurL, PurM-like module, C1 and C2 domains [111181] (3 species)
  7. 1432653Species Salmonella typhimurium [TaxId:99287] [229692] (1 PDB entry)
  8. 1432654Domain d4mgha4: 4mgh A:430-616 [229693]
    Other proteins in same PDB: d4mgha1, d4mgha2, d4mgha3, d4mgha5, d4mgha7
    automated match to d3ujna4
    complexed with act, adp, mg, mn, so4, xe

Details for d4mgha4

PDB Entry: 4mgh (more details), 2.65 Å

PDB Description: Importance of Hydrophobic Cavities in Allosteric Regulation of Formylglycinamide Synthetase: Insight from Xenon Trapping and Statistical Coupling Analysis
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d4mgha4:

Sequence, based on SEQRES records: (download)

>d4mgha4 d.139.1.1 (A:430-616) FGAM synthase PurL, PurM-like module, C1 and C2 domains {Salmonella typhimurium [TaxId: 99287]}
ivvgaklivlggpamniglgggaassmasgqsdadldfasvqrdnpemerrcqevidrcw
qlgdanpilfihdvgagglsnampelvsdggrggkfelrdilsdepgmspleiwcnesqe
ryvlavaadqlplfdelckrerapyavigdateeqhlslhdnhfdnqpidlpldvllgkt
pkmtrdv

Sequence, based on observed residues (ATOM records): (download)

>d4mgha4 d.139.1.1 (A:430-616) FGAM synthase PurL, PurM-like module, C1 and C2 domains {Salmonella typhimurium [TaxId: 99287]}
ivvgaklivlggpamnigfasvqrdnpemerrcqevidrcwqlgdanpilfihdvgaggl
snampelvsdggrggkfelrdilsdepgmspleiwcnesqeryvlavaadqlplfdelck
rerapyavigdateeqhlslhdnhfdnqpidlpldvllgktpkmtrdv

SCOPe Domain Coordinates for d4mgha4:

Click to download the PDB-style file with coordinates for d4mgha4.
(The format of our PDB-style files is described here.)

Timeline for d4mgha4: