SCOP 1.61: Domain d1ezlc_: 1ezl C:

Lineage for d1ezlc_ (1ezl C:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (32 PDB entries)

8. Domain d1ezlc_: 1ezl C: [22969]

Details for d1ezlc_

PDB Entry: 1ezl, 2 Å

PDB Description: crystal structure of the disulphide bond-deficient azurin mutant c3a/c26a: how important is the s-s bond for folding and stability?

SCOP Domain Sequences for d1ezlc_:

Sequence; same for both SEQRES and ATOM records:

>d1ezlc_ b.6.1.1 (C:) Azurin {Pseudomonas aeruginosa}
aeasvdiqgndqmqfntnaitvdksakqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

Timeline for d1ezlc_:

• d1ezlc_ first appeared (with stable ids) in SCOP 1.55
  
• d1ezlc_ appears in SCOP 1.59
  
• d1ezlc_ appears in SCOP 1.63
  
• d1ezlc_ appears in the current release, SCOPe 2.08