Lineage for d1ezlc_ (1ezl C:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55932Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 55933Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 55934Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 55952Protein Azurin [49530] (6 species)
  7. 55981Species Pseudomonas aeruginosa [TaxId:287] [49533] (22 PDB entries)
  8. 56014Domain d1ezlc_: 1ezl C: [22969]

Details for d1ezlc_

PDB Entry: 1ezl (more details), 2 Å

PDB Description: crystal structure of the disulphide bond-deficient azurin mutant c3a/c26a: how important is the s-s bond for folding and stability?

SCOP Domain Sequences for d1ezlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezlc_ b.6.1.1 (C:) Azurin {Pseudomonas aeruginosa}
aeasvdiqgndqmqfntnaitvdksakqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

SCOP Domain Coordinates for d1ezlc_:

Click to download the PDB-style file with coordinates for d1ezlc_.
(The format of our PDB-style files is described here.)

Timeline for d1ezlc_: