Lineage for d4mdkd_ (4mdk D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2939466Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 2939467Protein automated matches [190120] (9 species)
    not a true protein
  7. 2939474Species Human (Homo sapiens) [TaxId:9606] [186843] (28 PDB entries)
  8. 2939501Domain d4mdkd_: 4mdk D: [229681]
    Other proteins in same PDB: d4mdke1, d4mdke2, d4mdkf1, d4mdkf2, d4mdkg_, d4mdkh1, d4mdkh2
    automated match to d2ob4a_
    complexed with u94

Details for d4mdkd_

PDB Entry: 4mdk (more details), 2.61 Å

PDB Description: Cdc34-ubiquitin-CC0651 complex
PDB Compounds: (D:) Ubiquitin-conjugating enzyme E2 R1

SCOPe Domain Sequences for d4mdkd_:

Sequence, based on SEQRES records: (download)

>d4mdkd_ d.20.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pssqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkarlkfpi
dypysppafrfltkmwhpniyetgdvcisilhppvddpqsgelpserwnptqnvrtills
visllnepntfspanvdasvmyrkwkeskgkdreytdiirkqvlgtkvdaerdgvkvp

Sequence, based on observed residues (ATOM records): (download)

>d4mdkd_ d.20.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pssqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkarlkfpi
dypysppafrfltkmwhpniyetgdvcnptqnvrtillsvisllnepntfspanvdasvm
yrkwkeskgkdreytdiirkqvlgtkvdaerdgvkvp

SCOPe Domain Coordinates for d4mdkd_:

Click to download the PDB-style file with coordinates for d4mdkd_.
(The format of our PDB-style files is described here.)

Timeline for d4mdkd_: