Lineage for d4mcxe_ (4mcx E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709414Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. 2709415Protein Antitoxin HigA [158465] (2 species)
    Uncharacterized transcriptional regulator YddM
  7. 2709419Species Proteus vulgaris [TaxId:585] [229675] (3 PDB entries)
  8. 2709422Domain d4mcxe_: 4mcx E: [229677]
    automated match to d2icta_

Details for d4mcxe_

PDB Entry: 4mcx (more details), 2.1 Å

PDB Description: P. vulgaris HIGBA structure, crystal form 2
PDB Compounds: (E:) Antidote protein

SCOPe Domain Sequences for d4mcxe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mcxe_ a.35.1.3 (E:) Antitoxin HigA {Proteus vulgaris [TaxId: 585]}
mrqfkvshpgemiardledmgvsgrrfahnigvtpatvsrllagktaltpslsiriaaal
gstpefwlrlqsnydlrqlenqidtsgivlyg

SCOPe Domain Coordinates for d4mcxe_:

Click to download the PDB-style file with coordinates for d4mcxe_.
(The format of our PDB-style files is described here.)

Timeline for d4mcxe_: