Lineage for d4m78j_ (4m78 J:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2396390Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2396391Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2397050Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2397051Protein automated matches [190914] (14 species)
    not a true protein
  7. 2397106Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [228531] (5 PDB entries)
  8. 2397111Domain d4m78j_: 4m78 J: [229673]
    automated match to d4m75c_
    protein/RNA complex

Details for d4m78j_

PDB Entry: 4m78 (more details), 2.79 Å

PDB Description: Crystal structure of Lsm2-8 complex, space group P21
PDB Compounds: (J:) U6 snRNA-associated Sm-like protein LSm3

SCOPe Domain Sequences for d4m78j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m78j_ b.38.1.0 (J:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tpldllklnldervyiklrgartlvgtlqafdshsnivlsdavetiyqlnneelseserr
semvfirgdtvtlistp

SCOPe Domain Coordinates for d4m78j_:

Click to download the PDB-style file with coordinates for d4m78j_.
(The format of our PDB-style files is described here.)

Timeline for d4m78j_: