Lineage for d4m78e_ (4m78 E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2396390Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2396391Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2397050Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2397051Protein automated matches [190914] (14 species)
    not a true protein
  7. 2397073Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188389] (7 PDB entries)
  8. 2397083Domain d4m78e_: 4m78 E: [229670]
    automated match to d4c92e_
    protein/RNA complex

Details for d4m78e_

PDB Entry: 4m78 (more details), 2.79 Å

PDB Description: Crystal structure of Lsm2-8 complex, space group P21
PDB Compounds: (E:) U6 snRNA-associated Sm-like protein LSm5

SCOPe Domain Sequences for d4m78e_:

Sequence, based on SEQRES records: (download)

>d4m78e_ b.38.1.0 (E:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ilplevidktinqkvlivlqsnrefegtlvgfddfvnviledavewlidpedesrnekvm
qhhgrmllsgnniailvpg

Sequence, based on observed residues (ATOM records): (download)

>d4m78e_ b.38.1.0 (E:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ilplevidktinqkvlivlqsnrefegtlvgfddfvnviledavewlidnekvmqhhgrm
llsgnniailvpg

SCOPe Domain Coordinates for d4m78e_:

Click to download the PDB-style file with coordinates for d4m78e_.
(The format of our PDB-style files is described here.)

Timeline for d4m78e_: