SCOP 1.59: Domain d1ezla_: 1ezl A:

Lineage for d1ezla_ (1ezl A:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.6: Cupredoxins [49502] (1 superfamily)

4. Superfamily b.6.1: Cupredoxins [49503] (4 families)

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (31 PDB entries)

8. Domain d1ezla_: 1ezl A: [22967]

Details for d1ezla_

PDB Entry: 1ezl, 2 Å

PDB Description: crystal structure of the disulphide bond-deficient azurin mutant c3a/c26a: how important is the s-s bond for folding and stability?

SCOP Domain Sequences for d1ezla_:

Sequence; same for both SEQRES and ATOM records:

>d1ezla_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa}
aeasvdiqgndqmqfntnaitvdksakqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

Timeline for d1ezla_:

• d1ezla_ first appeared (with stable ids) in SCOP 1.55
  
• d1ezla_ appears in SCOP 1.57
  
• d1ezla_ appears in SCOP 1.61
  
• d1ezla_ appears in the current release, SCOPe 2.08